PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00047.121
Common NameAGL2, AMTR_s00047p00190220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family MIKC_MADS
Protein Properties Length: 244aa    MW: 27832.8 Da    PI: 9.1823
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00047.121genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.81e-31959151
                                              S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                                    SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                              krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  evm_27.model.AmTr_v1.0_scaffold00047.121  9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLYEFCS 59
                                              79***********************************************96 PP

2K-box104.61.2e-3481172899
                                     K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleq 76 
                                               ++ +++++s++qe+ kLk+++e+Lqr+qR+llGedL++Ls keL+qLeqqLe slk+iRs+K++ +++q
  evm_27.model.AmTr_v1.0_scaffold00047.121  81 NVPTRETQSSYQEYLKLKARVESLQRSQRNLLGEDLGPLSSKELEQLEQQLEMSLKQIRSTKTQCMFDQ 149
                                               4678899************************************************************** PP

                                     K-box  77 ieelqkkekelqeenkaLrkkle 99 
                                               + +l+++e +lqe+nkaL++kle
  evm_27.model.AmTr_v1.0_scaffold00047.121 150 LADLRRRELALQETNKALKRKLE 172
                                               ********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.529161IPR002100Transcription factor, MADS-box
CDDcd002653.10E-46278No hitNo description
SuperFamilySSF554554.84E-34285IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-33323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004048.6E-333859IPR002100Transcription factor, MADS-box
PfamPF014863.0E-2984171IPR002487Transcription factor, K-box
PROSITE profilePS5129715.91387177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0048481Biological Processplant ovule development
GO:0071486Biological Processcellular response to high light intensity
GO:0071492Biological Processcellular response to UV-A
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIIFSN RGKLYEFCST  60
SSMVKTLERY QKCNYGALET NVPTRETQSS YQEYLKLKAR VESLQRSQRN LLGEDLGPLS  120
SKELEQLEQQ LEMSLKQIRS TKTQCMFDQL ADLRRRELAL QETNKALKRK LEGASASNPP  180
QLAWENNGQN IHYNRQPAHT EGFFHPLECD STLQIGYHPS CPDQMPVAAP VQNVNAFLPG  240
WLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A5e-33751711101Developmental protein SEPALLATA 3
4ox0_B5e-33751711101Developmental protein SEPALLATA 3
4ox0_C5e-33751711101Developmental protein SEPALLATA 3
4ox0_D5e-33751711101Developmental protein SEPALLATA 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY8501790.0AY850179.1 Amborella trichopoda AGL2 mRNA, complete cds.
GenBankAY9362320.0AY936232.1 Amborella trichopoda AGL2 (AGL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292758.10.0uncharacterized protein LOC18446186
SwissprotQ034891e-118AGL9_PETHY; Agamous-like MADS-box protein AGL9 homolog
TrEMBLQ5D7250.0Q5D725_AMBTC; AGL2
STRINGVIT_14s0083g01050.t011e-124(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02310.15e-99MIKC_MADS family protein
Publications ? help Back to Top
  1. Zahn LM, et al.
    The evolution of the SEPALLATA subfamily of MADS-box genes: a preangiosperm origin with multiple duplications throughout angiosperm history.
    Genetics, 2005. 169(4): p. 2209-23
    [PMID:15687268]
  2. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]